General Information

  • ID:  hor005610
  • Uniprot ID:  P49125
  • Protein name:  Alpha-latrotoxin-associated low molecular weight protein
  • Gene name:  NA
  • Organism:  Latrodectus tredecimguttatus (Mediterranean black widow spider) (Latrodectus mactans tredecimguttatus)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Latrodectus (genus), Theridiidae (family), Araneoidea (superfamily), Orbiculariae, Entelegynae, Araneomorphae (suborder), Araneae (order), Arachnida (class), Chelicerata (subphylum), Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ISPADIGCTDISQADFDEKNNNCIKCGEDGFGEEMVNRCRDKCFTDNFYQSCVDLLNKVYEEKDTPPVQE
  • Length:  70(19-88)
  • Propeptide:  MSKLFFVVFLCLIISVFAISPADIGCTDISQADFDEKNNNCIKCGEDGFGEEMVNRCRDKCFTDNFYQSCVDLLNKVYEEKDTPPVQE
  • Signal peptide:  MSKLFFVVFLCLIISVFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May increase the toxicity of alpha-latrotoxin and/or other venom components. Is non-toxic to mice and to the cockroach Periplaneta americana
  • Mechanism:  Co-purifies with alpha-latrotoxin-Lt1a.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-C0HKS5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005610_AF2.pdbhor005610_ESM.pdb

Physical Information

Mass: 917767 Formula: C335H514N90O120S7
Absent amino acids: HW Common amino acids: D
pI: 3.91 Basic residues: 7
Polar residues: 24 Hydrophobic residues: 16
Hydrophobicity: -79.14 Boman Index: -18338
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 52.86
Instability Index: 4797.14 Extinction Coefficient cystines: 3355
Absorbance 280nm: 48.62

Literature

  • PubMed ID:  9792186
  • Title:  The low molecular weight protein which co-purifies with alpha-latrotoxin is structurally related to crustacean hyperglycemic hormones.Black widow spider toxins: the present and the future.